PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01300.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 413aa    MW: 43619.9 Da    PI: 8.9654
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01300.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.84.9e-3893152362
                   zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                              e+alkcprCdstntkfCy+nnysl+qPr+fCkaCrryWt+GGalr vPvGgg+r+nk+++
  Rsa1.0_01300.1_g00002.1  93 ETALKCPRCDSTNTKFCYFNNYSLTQPRHFCKACRRYWTRGGALRSVPVGGGCRRNKRTK 152
                              6789*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3680150IPR003851Zinc finger, Dof-type
PfamPF027014.2E-3295150IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.39496150IPR003851Zinc finger, Dof-type
PROSITE patternPS01361098134IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MVFSSFPTYP DSSNWQQQHQ PITSTVGFTG DNNISQQFLP HHPLPPQPQQ TPPPLHLSGN  60
GGGGGGGPGG PGGSIRPGSM AERARIANIP MPETALKCPR CDSTNTKFCY FNNYSLTQPR  120
HFCKACRRYW TRGGALRSVP VGGGCRRNKR TKNSSGGGGS SSSGNSKSQD STTSNDQYHH  180
RAMDNNQMGP PPSSTSLSSL LSSYNAGLIP GHDHNMSSNN HVLGLGSSLP PLKLMPPLDF  240
TDNFTLQYGT VSAPSYHVGG GSSGGGGAAS LLTGFDQWRF PAPHHQLPLL GGLDSSSSSS  300
GLYPFDHQNQ TGLEPQNPGY GLITGSGQYR AKNIFHNLVS SSVSSAMVTA TASQLASVKM  360
EDSNNQLNMS RQLFGTEQQL WNIHGTAAST AAATTSSWSD VSNNFSSSST SNI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2410230.0AC241023.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB039N20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013625612.11e-178PREDICTED: dof zinc finger protein DOF5.1-like
SwissprotQ9LZ561e-163DOF51_ARATH; Dof zinc finger protein DOF5.1
TrEMBLA0A078J0Z80.0A0A078J0Z8_BRANA; BnaA03g54830D protein
STRINGBra028872.1-P1e-176(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM115191732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.11e-131Dof family protein